Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

766 – 780 of 119,730 results

766

R&D Systems™ Recombinant Human Tyro3/Dtk Fc Chimera Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity

Pricing & Availability

767

R&D Systems™ Recombinant Human ALCAM/CD166 His-tag Protein

Pricing & Availability

768

Invitrogen™ Human PARP1 His-tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Accession Number	P09874
Regulatory Status	RUO
Conjugate	Unconjugated
Form	Liquid
Gene ID (Entrez)	142
Gene Symbol	Parp1
For Use With (Application)	Control,Bioactivity,Functional Assay,Immunohistochemistry,Western Blot
Source	Insect cells
Recombinant	Recombinant
Name	Human PARP1 His-tag

769

Novus Biologicals™ Recombinant Human HN1L His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

770

Promotions Available

R&D Systems™ Recombinant Bovine IL-2 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	15.6 kDa
Gene ID (Entrez)	280822
Quantity	20 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived bovine IL-2 protein Ala21-Thr155,with an N-terminal Met
Recombinant	Recombinant
Name	IL-2

771

Novus Biologicals™ Recombinant Human SOX2 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

772

Novus Biologicals™ Recombinant Human Kallikrein 5 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

773

Novus Biologicals™ PHPT1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	PHPT1
Molecular Weight (g/mol)	15.9kDa
Gene ID (Entrez)	29085
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 2mM DTT, 10% glycerol
Immunogen	PHPT1, 1-125 aa. MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

774

Novus Biologicals™ Recombinant Human ATPase Na+/K+ beta 3 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	ATPase, Na+/K+ transporting, beta 3 polypeptide, ATPB-3, CD298, CD298 antigen, FLJ29027, Na, K-ATPase beta-3 polypeptide, sodium/potassium-dependent ATPase beta-3 subunit, Sodium/potassium-dependent ATPase subunit beta-3, sodium/potassium-transporting ATPase beta-3 chain, sodium/potassium-transporting ATPase subunit beta-3
Common Name	ATPase Na+/K+ beta 3
Molecular Weight (g/mol)	TMW: 27.4kDa
Gene ID (Entrez)	483
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.15M NaCl, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

775

R&D Systems™ Recombinant Mouse SMOC-1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

776

Novus Biologicals™ Recombinant Human HMGCS1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) synthase, 3-hydroxy-3-methylglutaryl coenzyme A synthase, 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble), 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble), EC 2.3.3.10, HMG-CoA synthase, HMGCS, hydroxymethylglutaryl-CoA synthase, cytoplasmic, MGC90332
Common Name	HMGCS1
Molecular Weight (g/mol)	TMW: 59.7kDa
Gene ID (Entrez)	3157
Formulation	Phosphate buffered saline (pH7.4) containing 10% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

777

Novus Biologicals™ IGF2BP3 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

778

MilliporeSigma™ Creatine Phosphokinase, Rabbit Skeletal Muscle, Protein

Pricing & Availability

779

Novus Biologicals™ Recombinant Human CRHBP His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	corticotropin releasing hormone binding protein, corticotropin-releasing factor-binding protein, Corticotropin-releasing hormone-binding protein, CRFBPcorticotropin releasing hormone-binding protein, CRF-BPCRF-binding protein, CRH-BP
Common Name	CRHBP
Molecular Weight (g/mol)	TMW: 36.1kDa
Gene ID (Entrez)	1393
Formulation	20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.4M UREA
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

780

MilliporeSigma™ Endoglycosidase F3, Elizabethkingia meningosepticum, Recombinant Protein, E. coli

Pricing & Availability

Prev
1
...
50
51
52
53
...
7,982
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human HN1L His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human SOX2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Kallikrein 5 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PHPT1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human ATPase Na+/K+ beta 3 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human HMGCS1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ IGF2BP3 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human CRHBP His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human HN1L His Protein

Novus Biologicals™ Recombinant Human SOX2 His Protein

Novus Biologicals™ Recombinant Human Kallikrein 5 His Protein

Novus Biologicals™ PHPT1 Protein

Novus Biologicals™ Recombinant Human ATPase Na+/K+ beta 3 His Protein

Novus Biologicals™ Recombinant Human HMGCS1 His Protein

Novus Biologicals™ IGF2BP3 Recombinant Protein Antigen

Novus Biologicals™ Recombinant Human CRHBP His Protein